wilkinsonsupplyco.com valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
User-agent: * Disallow: Disallow: /Thank-You.HTML Disallow: /login.HTML User-agent: Googlebot-image Disallow: Sitemap:
Meta Tags
Title Wilkinson Supply Co -
Description Welcome to Wilkinson Supply Wilkinson Supply Co Trained staff is ready to assist you with your selection of plumbing fixtures. Our trained professionals will assist you in the proper selection of lights to fit your kitchen or bath design needs. Wilkinson Supply Co’s superior
Keywords Wilkinson Supply Co
Server Information
WebSite wilkinsonsupplyco faviconwilkinsonsupplyco.com
Host IP 199.96.124.1
Location United States
Related Websites
Site Rank
More to Explore
willametteegg.com
williamrussellwallace.com
williamsonsmusic.com
williamspaniel.com
willowbathandvanity.com
willowcreekcounselingky.com
willsie.com
windcaddie.com
windhammoms.org
windoorinc.com
windshieldreplacementmckinney.com
windsormeade.org
wineclubgroup.com
wineglassnecklace.com
wingsovercamarillo.com
winnerscircletrailers.com
winnerwood.com
winniesbalance.com
winniio.io
winpak.com
wilkinsonsupplyco.com Valuation
US$32,132,751
Last updated: 2023-05-08 15:25:31

wilkinsonsupplyco.com has Semrush global rank of 329,393. wilkinsonsupplyco.com has an estimated worth of US$ 32,132,751, based on its estimated Ads revenue. wilkinsonsupplyco.com receives approximately 3,707,626 unique visitors each day. Its web server is located in United States, with IP address 199.96.124.1. According to SiteAdvisor, wilkinsonsupplyco.com is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$32,132,751
Daily Ads Revenue US$29,662
Monthly Ads Revenue US$889,831
Yearly Ads Revenue US$10,677,961
Daily Unique Visitors 247,176
Note: All traffic and earnings values are estimates.
DNS Records
Host Type TTL Data
wilkinsonsupplyco.com. A 7200 IP: 199.96.124.1
wilkinsonsupplyco.com. NS 7200 NS Record: ns80.worldnic.com.
wilkinsonsupplyco.com. NS 7200 NS Record: ns79.worldnic.com.
wilkinsonsupplyco.com. MX 3600 MX Record: 1 aspmx.l.google.com.
wilkinsonsupplyco.com. MX 3600 MX Record: 5 alt1.aspmx.l.google.com.
wilkinsonsupplyco.com. MX 3600 MX Record: 5 alt2.aspmx.l.google.com.
wilkinsonsupplyco.com. MX 3600 MX Record: 10 aspmx3.googlemail.com.
wilkinsonsupplyco.com. MX 3600 MX Record: 10 aspmx2.googlemail.com.
wilkinsonsupplyco.com. TXT 7200 TXT Record: facebook-domain-verification=ay1iy5nbs9tjdr7mnt7ac63h2lnhrn
wilkinsonsupplyco.com. TXT 7200 TXT Record: google-site-verification=0K_StbCD3v9OIEgzj9VMlZ0_YyRzV_g5JEm3_AN2A5Y
wilkinsonsupplyco.com. TXT 7200 TXT Record: MS=ms82645522
wilkinsonsupplyco.com. TXT 7200 TXT Record: v=spf1 include:_spf.google.com include:_spf.google.com include:_spf.createsend.com mx include:spf.autopilothq.com include:sendgrid.net a:mail2.pfinders.com a:mail3.pfinders.com ~all
wilkinsonsupplyco.com. TXT 7200 TXT Record: google-site-verification=rU1023a_AGcHuBGHE0_PfXxII8m2o4UKeCvrfk1PI-E
HtmlToTextCheckTime:2023-05-08 15:25:31
Follow us on Facebook Follow us on Instagram Blog Wishlist ( 0 ) Login Visit Us Locations Carrboro Durham Fayetteville Raleigh Wilson Schedule a Design Consultation About Us 919-834-0395 search for a product Click to Call the location Get Directions Click to login ( 0 ) 919-834-0395 3300 Bush St. Raleigh, NC 27609 Navigate to the home page Kitchen Kitchen Faucets Sinks Bar and Prep Faucets Bar and Prep Sinks Pot Fillers Accessories Water Filtration Bath Bath Faucets Sinks Tubs Tub Faucets Showers Toilet Bidets Vanities Accessories Appliances Appliances Cooking Refrigeration Clean up Laundry Hoods Hardware Hardware Door Hardware Cabinet Hardware Lighting Lighting Chandeliers Pendants Wall Bath Flush Mount Semi-Flush Mount Outdoor Speciality Cabinetry Brands Visit Us Locations Schedule a Design Consultation About Us Enter Search Welcome to Wilkinson Supply Co Kitchen Bath Appliances Hardware Lighting Cabinets 5 Showroom Locations Carrboro 919-929-8260 103 Barnes Street Carrboro, NC
HTTP Headers
HTTP/1.1 301 Moved Permanently
Content-Length: 0
location: https://www.wilkinsonsupplyco.com/index.html
Set-Cookie: proxy-last-seen-date=%32%30%32%31%2d%31%30%2d%33%30; path=/; expires=Wednesday, 09-Nov-2099 23:12:40 GMT; HttpOnly

HTTP/1.1 200 OK
Content-Length: 206442
Content-Type: text/html
date: Sat, 30 Oct 2021 06:51:06 GMT
server: WebFronts Clustering Web Server
keep-alive: timeout=60, max=300
connection: keep-alive
accept-ranges: none
cache-control: private, no-cache
pragma: no-cache
Set-Cookie: proxy-last-seen-date=%32%30%32%31%2d%31%30%2d%33%30; path=/; expires=Wednesday, 09-Nov-2099 23:12:40 GMT; HttpOnly; secure
Set-Cookie: SESSIONID=%33%62%37%63%35%33%64%61%2d%65%64%36%31%2d%34%63%65%38%2d%39%30%65%38%2d%33%62%35%36%39%35%65%61%65%66%31%33; path=/; expires=Wednesday, 09-Nov-2099 23:12:40 GMT; HttpOnly; secure
Set-Cookie: consumer_profile_id=%32%36%37%33%30%31%31%31%35%39%37%32%33%33%36%37%32%32%39; path=/; expires=Wednesday, 09-Nov-2099 23:12:40 GMT; HttpOnly; secure
Set-Cookie: WF_ANALYTICS_KEY=%31%36%33%35%35%37%36%36%36%37%33%33%32; path=/; expires=Wednesday, 09-Nov-2099 23:12:40 GMT; HttpOnly; secure
wilkinsonsupplyco.com Whois Information
Domain Name: WILKINSONSUPPLYCO.COM
Registry Domain ID: 28673520_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://networksolutions.com
Updated Date: 2020-04-07T07:17:59Z
Creation Date: 2000-06-06T14:44:11Z
Registry Expiry Date: 2023-06-06T14:44:11Z
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: abuse@web.com
Registrar Abuse Contact Phone: +1.8003337680
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS79.WORLDNIC.COM
Name Server: NS80.WORLDNIC.COM
DNSSEC: unsigned
>>> Last update of whois database: 2021-09-17T17:36:04Z <<<